BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1639X (565 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 24 3.0 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 23 6.9 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 23 6.9 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.9 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 9.1 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 24.2 bits (50), Expect = 3.0 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +2 Query: 35 IAILLLGLVLANSGGARELTYPYGRTGNSPLDYQ*IDRETHK 160 I +LL GLV SG +Y +TG+ P Q I K Sbjct: 6 IFVLLAGLVALGSGIKLPASYSQCKTGDEPCVVQAITNTFQK 47 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.0 bits (47), Expect = 6.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 520 GTVSEVLHACHVDSAYERQQPLTTRRALV 434 GT+ + + + +A E Q PL RA+V Sbjct: 410 GTLKQAVGQIELQNATEEQSPLQLLRAIV 438 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.0 bits (47), Expect = 6.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 520 GTVSEVLHACHVDSAYERQQPLTTRRALV 434 GT+ + + + +A E Q PL RA+V Sbjct: 410 GTLKQAVGQIELQNATEEQSPLQLLRAIV 438 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 6.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 253 LKSYDVQNVYKYEYFK 206 LK YD V K EYFK Sbjct: 196 LKRYDNSKVLKREYFK 211 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 22.6 bits (46), Expect = 9.1 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 14 VEDFANEIAILLLGLVLANSGGARELTYPYGR 109 VEDFA +IA L +VL G L Y R Sbjct: 640 VEDFALDIACLFALIVLFRLGALLCLWLRYAR 671 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 531,543 Number of Sequences: 2352 Number of extensions: 9105 Number of successful extensions: 44 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -