Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1638
         (600 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|ch...    26   3.7  
SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc...    26   4.8  

>SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 546

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 177 TFFLPTFCVFPYL 139
           T+ LP FC FPYL
Sbjct: 230 TYVLPGFCTFPYL 242


>SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor
           Thi1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 775

 Score = 25.8 bits (54), Expect = 4.8
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = -2

Query: 488 HVDSAYERQQPLTTRRALV*STTDRDLKRCRRNLCK*CVFLISMVQN 348
           HV   Y+    LTTR  +V    D+DL    R   + CV   + V N
Sbjct: 514 HVQMIYDNAIMLTTRVIMVKKLKDKDLTAENRRYIQLCVESATRVIN 560


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,182,198
Number of Sequences: 5004
Number of extensions: 39430
Number of successful extensions: 87
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 84
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 87
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 262236260
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)