BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1636 (672 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0149 + 13194866-13195012,13196576-13196828,13197810-131981... 28 5.9 >01_03_0149 + 13194866-13195012,13196576-13196828,13197810-13198173, 13198283-13198501,13199888-13200002,13200697-13200948, 13201149-13201442 Length = 547 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -3 Query: 559 HTPHSPRTSVDLNVRVRYRIVFINFAIAVLFTWCVFYPNIIKRKDLFVSLS 407 H S R+S + + + A +F W + YP++ K D+FV LS Sbjct: 393 HFEVSMRSSGGFTLAAASFVGMDDIATKDIFEWILSYPSLFKTFDIFVRLS 443 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,585,106 Number of Sequences: 37544 Number of extensions: 282104 Number of successful extensions: 591 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -