BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1635 (769 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98866-26|CAM33505.1| 559|Caenorhabditis elegans Hypothetical p... 31 0.90 Z93785-2|CAB07859.2| 1335|Caenorhabditis elegans Hypothetical pr... 28 6.4 Z83316-4|CAB54187.3| 1050|Caenorhabditis elegans Hypothetical pr... 28 6.4 Z83316-3|CAB05895.3| 1054|Caenorhabditis elegans Hypothetical pr... 28 6.4 Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical pr... 28 8.4 >Z98866-26|CAM33505.1| 559|Caenorhabditis elegans Hypothetical protein Y49E10.29 protein. Length = 559 Score = 31.1 bits (67), Expect = 0.90 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +1 Query: 145 PPKRPSSAKTRVQTKLTRPRCSQGSVKDTPKYSEPNNIKKA 267 PPK PS + TK R S GS TPK+++P+ KA Sbjct: 469 PPKEPSISSEPTTTKKPRKSFSPGSA--TPKHTQPSENGKA 507 >Z93785-2|CAB07859.2| 1335|Caenorhabditis elegans Hypothetical protein W09D10.2 protein. Length = 1335 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 360 FWSWRTTWSMFLNQK*FRVFLCNIFFFSYI 449 +W+W WSMFL+ F F+C + + ++ Sbjct: 1199 YWTWPMFWSMFLSVLLF--FICALLYNGFV 1226 >Z83316-4|CAB54187.3| 1050|Caenorhabditis elegans Hypothetical protein B0379.3b protein. Length = 1050 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 118 RKTARAC*RPPKRPSSAKTRVQTKLTRPRCSQGSVKDTPKYSE-PN 252 R T R+ RPP+ P+S RV T P QG+ P+ S PN Sbjct: 438 RNTDRSTSRPPRAPTSPVNRVME--TDPLMGQGTSSGAPQRSAIPN 481 >Z83316-3|CAB05895.3| 1054|Caenorhabditis elegans Hypothetical protein B0379.3a protein. Length = 1054 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 118 RKTARAC*RPPKRPSSAKTRVQTKLTRPRCSQGSVKDTPKYSE-PN 252 R T R+ RPP+ P+S RV T P QG+ P+ S PN Sbjct: 442 RNTDRSTSRPPRAPTSPVNRVME--TDPLMGQGTSSGAPQRSAIPN 485 >Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical protein F28D9.1 protein. Length = 601 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 79 AVTRSKRYTG-ADRRKTARAC*RPPKRPSSAKTRVQTKLTRPRCSQGSVKDTP 234 A +RSK A RR++ A PP P AK+R ++ R R S + K P Sbjct: 334 AKSRSKSPPAPARRRRSPSASKSPPPAPKRAKSRSKSPPARRRRSPSASKSPP 386 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,872,848 Number of Sequences: 27780 Number of extensions: 383907 Number of successful extensions: 863 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -