BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1634 (716 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4AXN1 Cluster: Polysaccharide deacetylase family prote... 33 5.3 UniRef50_Q75EW7 Cluster: AAL039Cp; n=1; Eremothecium gossypii|Re... 33 9.3 >UniRef50_A4AXN1 Cluster: Polysaccharide deacetylase family protein; n=1; Alteromonas macleodii 'Deep ecotype'|Rep: Polysaccharide deacetylase family protein - Alteromonas macleodii 'Deep ecotype' Length = 391 Score = 33.5 bits (73), Expect = 5.3 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 571 IILYSHIPSCKTAVSVDPSDTTSSHIQYITTHSTVM 464 I+LY H+ S A + +T SH++Y+ TH TV+ Sbjct: 69 ILLYHHVSSSTPASTSISPETFKSHMEYLETHHTVV 104 >UniRef50_Q75EW7 Cluster: AAL039Cp; n=1; Eremothecium gossypii|Rep: AAL039Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 283 Score = 32.7 bits (71), Expect = 9.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 562 YSHIPSCKTAVSVDPSDTTSSHIQYITTHST 470 Y H P C +S DP DT + H+Q +T Sbjct: 156 YDHCPLCNADLSGDPEDTAAEHVQNCIARAT 186 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,200,678 Number of Sequences: 1657284 Number of extensions: 12396315 Number of successful extensions: 23509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23500 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57851245060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -