BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1634 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16A10.06c |nse2||Smc5-6 complex non-SMC subunit 2 |Schizosac... 27 2.7 SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyc... 25 8.2 >SPAC16A10.06c |nse2||Smc5-6 complex non-SMC subunit 2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 250 Score = 27.1 bits (57), Expect = 2.7 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 529 SVDP-SDTTSSHIQYITTHSTVMTFLYYYIYIRMEHTE 419 SVD ++ TS +I +T MTFL + +Y+ E+ E Sbjct: 80 SVDTLANKTSENISDFEVRTTEMTFLLFLLYVDEEYEE 117 >SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyces pombe|chr 3|||Manual Length = 1088 Score = 25.4 bits (53), Expect = 8.2 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 270 NVLSEIKHPSNILYDANASISTIQCF 193 N L K P IL +NAS+STI+ F Sbjct: 538 NELVNEKAPELILNKSNASVSTIELF 563 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,868,947 Number of Sequences: 5004 Number of extensions: 58203 Number of successful extensions: 109 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -