BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1634 (716 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098999-4|AAC68729.1| 659|Caenorhabditis elegans Hypothetical ... 28 5.8 AC006780-3|AAF60649.2| 425|Caenorhabditis elegans Hypothetical ... 28 5.8 >AF098999-4|AAC68729.1| 659|Caenorhabditis elegans Hypothetical protein W04C9.6 protein. Length = 659 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 258 EIKHPSNILY-DANASISTIQCF*LNFN*VYTVQTVESFLL*YFFQSLNYDSLS 100 ++ P N+ + S+S C+ +F + TVQ V F Y LNYD LS Sbjct: 240 KVSRPKNLPFRHILTSLSLWACWIASFGDLITVQLVSQFNPQYMKNYLNYDVLS 293 >AC006780-3|AAF60649.2| 425|Caenorhabditis elegans Hypothetical protein Y47D9A.5 protein. Length = 425 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 357 GISIGCYCSVDRRSACCGS*LVYTQTY-LENVLS 259 GISI CYC+ +AC S ++ Y L+N ++ Sbjct: 87 GISINCYCAKSFFAACLSSTIIAESIYQLKNTIN 120 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,515,770 Number of Sequences: 27780 Number of extensions: 318246 Number of successful extensions: 658 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -