BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1632 (795 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.08c |phf2|swp2, saf60|PHD finger containing protein Ph... 26 7.1 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 7.1 SPBC2G2.08 |ade9||C-1-tetrahydrofolatesynthase/methylenetetrahyd... 26 7.1 >SPAC30D11.08c |phf2|swp2, saf60|PHD finger containing protein Phf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 538 Score = 25.8 bits (54), Expect = 7.1 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -3 Query: 382 HLTYQTRHFH--SLYYYFFQDYKNNNIAKKIRFFK 284 HL Q +HFH + F YKN+++AK+I K Sbjct: 69 HLENQFQHFHEPNKESGAFGSYKNDDVAKEIESSK 103 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.8 bits (54), Expect = 7.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 412 ICTYIFVFLFIYLFALLRKYSVLIFSQFVSS 504 +C++ F L+ ++FA L + L VSS Sbjct: 24 VCSFFFPLLYSFIFATLHAFVFLFSHTLVSS 54 >SPBC2G2.08 |ade9||C-1- tetrahydrofolatesynthase/methylenetetrahydrofolatedehydr ogenase/methylenetetrahydrofolatecyclohydrolase/formylte trahydrofolatesynthetase|Schizosaccharomyces pombe|chr 2|||Manual Length = 969 Score = 25.8 bits (54), Expect = 7.1 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = -3 Query: 316 NNIAKKIRFFKRDISKGSGLKSKVDLLILLQLKFN*N*NYTLL 188 +N+AK++ + ++ K+KV+L + +LK + NY ++ Sbjct: 354 SNLAKEMGIYDTELENYGNYKAKVNLAVYERLKHRKDGNYVVV 396 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,854,598 Number of Sequences: 5004 Number of extensions: 55538 Number of successful extensions: 122 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 387388442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -