BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1629 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 22 4.4 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 22 4.4 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 22 5.8 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 5.8 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 7.7 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 22.2 bits (45), Expect = 4.4 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 387 TDYNNYAIAYNCKY 428 ++YNNY ++C+Y Sbjct: 222 SNYNNYQEGFSCQY 235 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 22.2 bits (45), Expect = 4.4 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 387 TDYNNYAIAYNCKY 428 ++YNNY ++C+Y Sbjct: 242 SNYNNYQEGFSCQY 255 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 562 HKFRRVYLFGVFLDEIIDAVLASPSSFLFL 473 ++FR F VFL +II V + +S L + Sbjct: 65 NQFRSYSNFSVFLFDIITIVTLTSTSILLI 94 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/29 (31%), Positives = 12/29 (41%) Frame = +3 Query: 339 FKFGEISRDGSVQVLATDYNNYAIAYNCK 425 F FG + +G YNN + CK Sbjct: 15 FHFGAFTCEGCKSFFGRTYNNISSISECK 43 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 237 EGQERAIIDGVKKYIEGTAKLT 302 EG+ R I DG++ I + K+T Sbjct: 197 EGRFRVINDGIQALINDSRKVT 218 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,163 Number of Sequences: 336 Number of extensions: 2767 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -