BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1627 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 1.8 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 25 3.1 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 7.2 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 7.2 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 9.5 AF185643-1|AAF15578.1| 117|Anopheles gambiae Toll-related prote... 23 9.5 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -3 Query: 404 FFCNSTHGLSFAHAIAPVDSKTHPVHKNC 318 FFC++ L ++P+DS +H + + C Sbjct: 2713 FFCSNVVRLVALQVVSPIDSISHGLEQIC 2741 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 24.6 bits (51), Expect = 3.1 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 170 INSHNQSLEFSFFLFKSWQRRNNSTAQILILIYLV 274 I SH S+ S+F F W N +L++++++ Sbjct: 141 IESHFGSVVASYFTFLRWLFSVNIVISVLLVVFIM 175 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 119 CLKYLKAPLVDREEENTINSHNQSLEFSFFLFK-SWQRRNNSTAQIL 256 C+K + L+D +N I + N +E S++ +K W+ + Q+L Sbjct: 56 CIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVQML 102 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 119 CLKYLKAPLVDREEENTINSHNQSLEFSFFLFK-SWQRRNNSTAQIL 256 C+K + L+D +N I + N +E S++ +K W+ + Q+L Sbjct: 56 CIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVQML 102 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.0 bits (47), Expect = 9.5 Identities = 6/18 (33%), Positives = 14/18 (77%) Frame = +1 Query: 388 VLLQKNYAKNSFCKFNFR 441 ++L +N+ K+ +C+F F+ Sbjct: 1144 MVLSENFIKSEWCRFEFK 1161 >AF185643-1|AAF15578.1| 117|Anopheles gambiae Toll-related protein protein. Length = 117 Score = 23.0 bits (47), Expect = 9.5 Identities = 6/18 (33%), Positives = 14/18 (77%) Frame = +1 Query: 388 VLLQKNYAKNSFCKFNFR 441 ++L +N+ K+ +C+F F+ Sbjct: 58 MVLSENFIKSEWCRFEFK 75 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,214 Number of Sequences: 2352 Number of extensions: 12869 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -