BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1627 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.7 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.7 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.9 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 8.9 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 6.7 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 119 CLKYLKAPLVDREEENTINSHNQSLEFSFFLFK-SWQRRNNSTAQIL 256 C+K + L+D +N I + N +E S++ +K W+ + ++L Sbjct: 57 CIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVKML 103 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 6.7 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 119 CLKYLKAPLVDREEENTINSHNQSLEFSFFLFK-SWQRRNNSTAQIL 256 C+K + L+D +N I + N +E S++ +K W+ + ++L Sbjct: 57 CIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVKML 103 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 405 VFLQQYPW 382 VF QQYPW Sbjct: 93 VFWQQYPW 100 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 405 VFLQQYPWI 379 +F QQYPW+ Sbjct: 100 LFWQQYPWV 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,668 Number of Sequences: 438 Number of extensions: 3895 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -