BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1625 (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domai... 25 1.9 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 7.8 >DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domain polypeptide protein. Length = 161 Score = 25.4 bits (53), Expect = 1.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 586 TGRDSGCSCVTRIQRLYFC 530 T D GC+C RI+ Y C Sbjct: 102 TLNDGGCNCAVRIRHAYPC 120 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.4 bits (48), Expect = 7.8 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 167 QILLQDELRGPGHGDTG--GGVQRRGHAAHVQGKVMARVKSVD 289 ++L + GPGHG G G + G AA V G+ A + D Sbjct: 342 ELLCRTSAGGPGHGSGGHSNGSRANGGAATV-GRTRAARTATD 383 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,436 Number of Sequences: 2352 Number of extensions: 9504 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -