BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1625 (763 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 4.1 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 4.1 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 4.1 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 7.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.4 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 130 LSVSGAAGTLKR*GTGSXRNVTTTTV 53 +++ G T R TGS TTTTV Sbjct: 282 VTIGGGGTTSSRRTTGSRAAATTTTV 307 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 130 LSVSGAAGTLKR*GTGSXRNVTTTTV 53 +++ G T R TGS TTTTV Sbjct: 282 VTIGGGGTTSSRRTTGSRAAATTTTV 307 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 130 LSVSGAAGTLKR*GTGSXRNVTTTTV 53 +++ G T R TGS TTTTV Sbjct: 282 VTIGGGGTTSSRRTTGSRAAATTTTV 307 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 7.1 Identities = 13/69 (18%), Positives = 30/69 (43%) Frame = -1 Query: 304 QMAPLVDALDARHDLALNMGSVSASLHTSSCITVSRSAQFVLKKYLKFPFLGR*SLKSLS 125 + A + + D R+ S ++ + + S + + +FP LGR +++ + Sbjct: 371 KFADIKEKCDRRNGKTTEENPKSIKSGDAAIVMLVPSKPMCAEAFQEFPPLGRFAVRDMR 430 Query: 124 VSGAAGTLK 98 + A G +K Sbjct: 431 QTVAVGVIK 439 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +1 Query: 250 CSGQGHGARQERRLVAPSGHGARQERRLVA 339 CSG+ + + PSGH A L A Sbjct: 500 CSGEVASLTEYHHVAPPSGHHASSAPLLAA 529 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,513 Number of Sequences: 438 Number of extensions: 2723 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -