BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1621 (838 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z32645-1|CAA83567.1| 258|Anopheles gambiae chymotrypsinogen-lik... 24 6.6 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 8.7 >Z32645-1|CAA83567.1| 258|Anopheles gambiae chymotrypsinogen-like protease ANCHYM2 protein. Length = 258 Score = 23.8 bits (49), Expect = 6.6 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = -3 Query: 149 IPVNRLMSPFGWTRWSLD-----MIRPTSLVSVANTSTFARVNNP 30 +PVN + GW R S + +++ ++V+++N A++ NP Sbjct: 145 VPVNATVRLTGWGRTSTNGNVPTLLQSLNVVTLSNEDCKAKMGNP 189 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 329 PPFDYLCQHTKWERHIDWGKSPCVC 403 P +D LCQ H+D G VC Sbjct: 333 PSYDRLCQQCHKALHLDIGLRCVVC 357 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 781,423 Number of Sequences: 2352 Number of extensions: 14971 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -