BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1620 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.6 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 3.6 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.6 Identities = 15/67 (22%), Positives = 33/67 (49%) Frame = +3 Query: 324 SFERRLDRPAESIRFETPMFVGGVDDSTVVVNPNAGVSGGFSGCIKDVVLNSNAVDINSS 503 S +R A S++ E + + S V++P +S C+ + S+ VD+++ Sbjct: 882 SDRKRPASQATSVKAEPGSIMAMSESSKKVLSPGELLSS----CVSNDGGCSSLVDVSTP 937 Query: 504 INRRTFK 524 +N++ +K Sbjct: 938 VNKKVYK 944 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +3 Query: 195 LRPWIRKHSRGAYK*QAIARNQWIDIQIARLADSVSMEINLVRS 326 L P++ S Y+ + R W+++Q ++DS S V + Sbjct: 323 LDPYVYAISHPKYRLELQKRLPWLELQEKPISDSTSTTTETVNT 366 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,118 Number of Sequences: 438 Number of extensions: 4100 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -