BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1618 (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68317-4|CAA92688.1| 486|Caenorhabditis elegans Hypothetical pr... 30 1.8 AL021386-3|CAA16167.1| 330|Caenorhabditis elegans Hypothetical ... 28 7.3 >Z68317-4|CAA92688.1| 486|Caenorhabditis elegans Hypothetical protein T01H3.4 protein. Length = 486 Score = 29.9 bits (64), Expect = 1.8 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = -3 Query: 632 IIDDSNKTKDTRKFYIFLIIKNLNFKTISFTYKSNITHNTRSRDKIKCS 486 II+DS +K+ R F IFLI KT+ TY + R R ++ S Sbjct: 333 IINDSKFSKNDRVFEIFLINDETPKKTVYSTYGQLLYTGKRLRSAVQLS 381 >AL021386-3|CAA16167.1| 330|Caenorhabditis elegans Hypothetical protein F57E7.3 protein. Length = 330 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = -1 Query: 382 LITTHLFPIKKFSSSP---KHNRRVCQIKFSLNIIFLTITNLQLFFNFIIFREML 227 L++ FP+ F + K + ++KFS+ + LT T L +FFN++ M+ Sbjct: 21 LLSCIQFPVNAFGTYIILFKTPNNLGKVKFSILTMHLTCTWLDIFFNYLAIPYMI 75 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,959,024 Number of Sequences: 27780 Number of extensions: 302389 Number of successful extensions: 772 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -