BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1617 (673 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.12 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 3.3 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 5.7 SPBC1703.08c |||5-formyltetrahydrofolate cyclo-ligase|Schizosacc... 26 5.7 SPAC22F8.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.9 >SPAC27E2.12 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 76 Score = 26.6 bits (56), Expect = 3.3 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +3 Query: 513 CVVCYIRLVCK*YC 554 CVVC++ ++C+ YC Sbjct: 35 CVVCFVSVLCRLYC 48 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.8 bits (54), Expect = 5.7 Identities = 17/67 (25%), Positives = 27/67 (40%), Gaps = 4/67 (5%) Frame = -2 Query: 189 VIHPQYKRLFRTRLMNNTKAIVIFVFWCFFF----KQKTHFSCRIMYT*FSLTNLSYLLE 22 ++ Q++RL ++T I F +W FFF F I + + + Sbjct: 51 LVSSQFRRLKLPYHHHHTFTIEAFFYWFFFFFFFFSHCRRFHIAIFIHPYDSNVVPFFCF 110 Query: 21 FFYFQTF 1 FFYF F Sbjct: 111 FFYFSLF 117 >SPBC1703.08c |||5-formyltetrahydrofolate cyclo-ligase|Schizosaccharomyces pombe|chr 2|||Manual Length = 204 Score = 25.8 bits (54), Expect = 5.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 234 SRNIMKLKNNCRLVIVKKIIFNENL 308 SR IM + +C L+IV + F+E L Sbjct: 111 SRKIMDDETDCELIIVPGVAFDEKL 135 >SPAC22F8.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 133 Score = 25.0 bits (52), Expect = 9.9 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 480 LNTAFNFVSRPCVVCYIR 533 LNT+F+F S C++C+ + Sbjct: 17 LNTSFSFSSLLCILCFYK 34 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,656,181 Number of Sequences: 5004 Number of extensions: 53505 Number of successful extensions: 126 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -