BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1615X (401 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 2.0 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 6.0 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 20 7.9 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 2.0 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -2 Query: 259 RQHLKDASPVLDHAICKSYPDSSKLTTSDARP 164 R+H+K A PV+ + C S++L P Sbjct: 67 RRHIKGAIPVVSLSTCSMLCGSTQLWPQPTGP 98 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 20.6 bits (41), Expect = 6.0 Identities = 7/18 (38%), Positives = 7/18 (38%) Frame = +1 Query: 250 NVALSTFDGSFCDYHGCH 303 N FDG C CH Sbjct: 100 NTGRCAFDGICCSQDSCH 117 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.2 bits (40), Expect = 7.9 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = +2 Query: 41 WFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDG 163 WF + T IT ++H ++ T+ M + DG Sbjct: 1146 WFDENTKDTKITAASETILHGLKKYTNYSMEVLAYTSGGDG 1186 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,052 Number of Sequences: 336 Number of extensions: 1811 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8646818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -