BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1615X (401 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_1002 + 10171942-10172859,10173369-10173452 27 4.2 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 27 4.2 02_05_0280 + 27435166-27435254,27436348-27436437,27436764-274368... 27 5.6 01_06_1128 - 34724469-34724699,34726103-34726213,34726301-347264... 27 7.3 09_02_0388 - 8450728-8450836,8451114-8451229,8451618-8451827 26 9.7 04_04_0895 - 29168107-29168229,29168617-29170068 26 9.7 >08_01_1002 + 10171942-10172859,10173369-10173452 Length = 333 Score = 27.5 bits (58), Expect = 4.2 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 163 RASRPKSLILMN--LDNFCRSHGQVPATHLSNVALSTFDGS 279 RA + SL L +DN CR G++P + +N+++ F G+ Sbjct: 242 RAPKLHSLTLWTPAVDNGCRVAGELPLLNAANISVDAFLGT 282 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 27.5 bits (58), Expect = 4.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 372 PSLDVVAVSQAPSPESNPDSPLP 304 P LD ++Q PSP +NP P P Sbjct: 55 PPLDEETLAQFPSPPTNPSPPPP 77 >02_05_0280 + 27435166-27435254,27436348-27436437,27436764-27436866, 27437318-27437377,27437745-27439148,27439227-27439328, 27439424-27439609,27439695-27439820,27439905-27440000, 27440509-27440574 Length = 773 Score = 27.1 bits (57), Expect = 5.6 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +1 Query: 94 NTCNQNSDQ*WDECFY*IKTNRRR 165 N+ N++SDQ +C+Y +KTNR++ Sbjct: 741 NSLNRSSDQ-ISKCYYSLKTNRKQ 763 >01_06_1128 - 34724469-34724699,34726103-34726213,34726301-34726409, 34726517-34726581,34726661-34726838,34726918-34726997, 34727838-34727961,34728064-34728172,34728299-34728461 Length = 389 Score = 26.6 bits (56), Expect = 7.3 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 44 FLRSYSVTWITVVILELIHAIRTLTSDGMSAF 139 F+R Y TW + +L+ + TLT S F Sbjct: 241 FIRCYDCTWTLIDEYDLVDPVHTLTPPEESGF 272 >09_02_0388 - 8450728-8450836,8451114-8451229,8451618-8451827 Length = 144 Score = 26.2 bits (55), Expect = 9.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 372 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAET 277 PS A + + SP PD PLP+ +M+ + T Sbjct: 7 PSAAAAAATSSSSPRP-PDRPLPICSMLASYT 37 >04_04_0895 - 29168107-29168229,29168617-29170068 Length = 524 Score = 26.2 bits (55), Expect = 9.7 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = -2 Query: 379 PAAFLGCGSRFSGSLSGIEP*FPVTRDNHGSRRNYHRKLIRQHLKDASPVLDHAICKSYP 200 PA + +R + +L G + VTR R N R R ++ D LDH + P Sbjct: 420 PAVYYLSSARRAAALRGGDT--TVTRYERWRRANETRPACRWNIADPDAHLDHIVVLKKP 477 Query: 199 D 197 D Sbjct: 478 D 478 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,263,355 Number of Sequences: 37544 Number of extensions: 223596 Number of successful extensions: 709 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -