BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1614 (787 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 24 6.1 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 8.1 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.8 bits (49), Expect = 6.1 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 2/121 (1%) Frame = -1 Query: 430 RLLPSLDVVAVSQAPSPESNPD--SPLPVTTMVVAETTIES**GRHLKDASPVLDHAICK 257 RL +++ +S P P ++P SP + + A +S + + S L H CK Sbjct: 354 RLRWMMEMPGMSVPPQPHTHPSYGSPAEIPKHISALGAKQS--KMEVMELSD-LHHPNCK 410 Query: 256 SIQIHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACISSRITTVIQVTE*DLRNQN*YI 77 N +L + G IG D + S +L++ +S+ T ++ LRN++ YI Sbjct: 411 -----MNRKLNS-GDLGIGADSCRRESESSDSILLSPEASKATEAVEFIAEHLRNEDLYI 464 Query: 76 E 74 + Sbjct: 465 Q 465 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.4 bits (48), Expect = 8.1 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -2 Query: 477 RYFSSLPPVPGVGNLRACCLPWMW*PFLRLPLRNRTLIPRYP 352 RY L + + NLR + LR NRT PRYP Sbjct: 263 RYAQGLGRIEPLANLREPVREAYYPKLLRTS-NNRTFCPRYP 303 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 841,281 Number of Sequences: 2352 Number of extensions: 18120 Number of successful extensions: 41 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -