BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1613 (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 79 2e-16 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 38 5e-04 Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 32 0.023 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 26 1.5 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 6.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 6.0 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 6.0 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 7.9 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 7.9 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 7.9 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 79.0 bits (186), Expect = 2e-16 Identities = 38/84 (45%), Positives = 53/84 (63%), Gaps = 3/84 (3%) Frame = +2 Query: 254 LGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYY 433 +GKSSL+ RF + +F+ +STIG F T+++ +D T+K +IWDTAGQERY ++ YY Sbjct: 35 VGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFEIWDTAGQERYHSLAPMYY 94 Query: 434 RGAWARCW---FTTSPSTCRTRTW 496 RGA A S S R +TW Sbjct: 95 RGAQAAIVVYDIQNSDSFARAKTW 118 Score = 65.7 bits (153), Expect = 2e-12 Identities = 34/86 (39%), Positives = 49/86 (56%) Frame = +1 Query: 448 ALLVYDIAKHLSYENVERWLPSCAIHADQNILIMLVGNKSDLRHLRSIPTEEAKAFAEAN 627 A++VYDI S+ + W+ A NI+I L GNK+DL + R + EEAK +A+ N Sbjct: 100 AIVVYDIQNSDSFARAKTWVKELQRQASPNIVIALAGNKADLANSRVVDYEEAKQYADDN 159 Query: 628 GLSFIETSALDSTNVEPAFQNILTEI 705 L F+ETSA + NV F I ++ Sbjct: 160 RLLFMETSAKTAVNVNDIFLAIAKKL 185 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 37.5 bits (83), Expect = 5e-04 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 2/77 (2%) Frame = +2 Query: 254 LGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYY 433 +GK+ +L +T + F E T ++ + VDG + +WDTAGQE Y + Y Sbjct: 17 VGKTCMLISYTTDSFPGEYVPTSFDNYSAPMV-VDGVQVSLGLWDTAGQEDYDRLRPLSY 75 Query: 434 --RGAWARCWFTTSPST 478 + C+ SPS+ Sbjct: 76 PQTDVFLICYSVASPSS 92 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 31.9 bits (69), Expect = 0.023 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 451 LLVYDIAKHLSYENV-ERWLPSCAIHADQNILIMLVGNKSDLRHLRSIPTEEAK 609 L+ + + S+ENV E+W+P H Q +LVG + DLR S + AK Sbjct: 22 LVCFSVVSPSSFENVKEKWVPEITHHC-QKTPFLLVGTQIDLRDENSTLEKLAK 74 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 25.8 bits (54), Expect = 1.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 372 FMVLPSTSILLVANSTPMVDLDSKLNSFLVKRD 274 F +L +L++ + P+V D LN F + D Sbjct: 493 FHLLAGQPLLIIGTTGPLVLFDEALNQFCISND 525 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 373 SSDMGHGRPGAVPRHHVGVLPRRVGA 450 ++ +G G+P A PR LPRR A Sbjct: 189 AAKVGGGQPSASPRQPPTPLPRRSSA 214 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 6.0 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 636 TKSVGFRERFRLLRRDGPKMPEI 568 TK + F++RF + D +MPE+ Sbjct: 138 TKWLTFKDRFSSMVHDSTEMPEV 160 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 41 NHN*KVMLKEPCIVL*ICDICVQYY 115 +H KV+ K P I C+I V+Y+ Sbjct: 131 HHTGKVVWKPPAIYKSFCEIDVEYF 155 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 461 TTSPSTCRTRTWSD 502 TT+P++ T TWSD Sbjct: 196 TTTPASTTTTTWSD 209 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 461 TTSPSTCRTRTWSD 502 TT+P++ T TWSD Sbjct: 195 TTTPASTTTTTWSD 208 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 461 TTSPSTCRTRTWSD 502 TT+P++ T TWSD Sbjct: 195 TTTPASTTTTTWSD 208 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,622 Number of Sequences: 2352 Number of extensions: 14797 Number of successful extensions: 31 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -