BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1613 (774 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 3.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 3.2 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 5.5 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 5.5 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 9.6 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 41 NHN*KVMLKEPCIVL*ICDICVQYY 115 +H KV+ K P I C+I V+Y+ Sbjct: 128 HHTGKVVWKPPAIYKSFCEIDVEYF 152 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 3.2 Identities = 8/19 (42%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Frame = +2 Query: 428 YYRGAWAR-CWFTTSPSTC 481 YY W + CW T+P+ C Sbjct: 485 YYPCCWWKICWTITTPAIC 503 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 3.2 Identities = 8/19 (42%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Frame = +2 Query: 428 YYRGAWAR-CWFTTSPSTC 481 YY W + CW T+P+ C Sbjct: 538 YYPCCWWKICWTITTPAIC 556 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 96 IFVSNIIFIYGHLDVSKLTD 155 IF+ IIFIY + ++++TD Sbjct: 13 IFLILIIFIYSNETIAQVTD 32 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 96 IFVSNIIFIYGHLDVSKLTD 155 IF+ IIFIY + ++++TD Sbjct: 13 IFLILIIFIYSNETIAQVTD 32 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +1 Query: 427 VLPRRVGALLVYDIAKHLSYENVERWLPSCAIHADQNI 540 +L R+ + ++ K + ++ W+P+ AIH D I Sbjct: 372 ILMRKAISDYTFNDTKITIPKEMKIWIPAFAIHRDSAI 409 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,495 Number of Sequences: 438 Number of extensions: 4269 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -