BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1609 (838 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596,972... 29 4.6 03_06_0643 + 35248597-35250585,35250663-35250773,35250867-352509... 28 8.0 >09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596, 9726900-9727847 Length = 743 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 196 KVLRSNRQPGDDSAILIYGILGLLKSTLLSFHYQEKEQG 80 K L S P D S + I G+ GL K++L +++KE+G Sbjct: 130 KDLLSQSNPDDLSILPIVGLPGLGKTSLARLVFEDKEEG 168 >03_06_0643 + 35248597-35250585,35250663-35250773,35250867-35250971, 35252215-35252304 Length = 764 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +3 Query: 429 LLENSYTSSANASLDFMNIASFISSKVNLIEVHSTLHTFRFYCRIPN 569 LL+N Y + L+ ++ + + SK + E S L+TF+ + ++ N Sbjct: 409 LLQNKYKMEEDDDLESLSRSRVLVSKFPMEEQLSRLYTFKMFTKLQN 455 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,936,100 Number of Sequences: 37544 Number of extensions: 294980 Number of successful extensions: 586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2315199948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -