BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1609 (838 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal ... 24 5.0 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 6.6 AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 23 8.7 >AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal carrier protein TOL-1 protein. Length = 272 Score = 24.2 bits (50), Expect = 5.0 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = +3 Query: 381 HISLINVIKY*YALTQLLENSYTSSANASLDFMNIASFISSKVNLIEVHSTLHTFRFYCR 560 H+ I+ +K + ++L+ S NASL + + F S+KV V S + + R Sbjct: 77 HVGTIDPMKI--SKIRILQGDGPVSVNASLSKVVVTGFASTKVLRNVVSSKNFGWETHIR 134 Query: 561 IPNV 572 +P + Sbjct: 135 LPKM 138 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.8 bits (49), Expect = 6.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 228 FFCPRFLRYRERFYAVIVNRAMTP 157 F CPRF R R ++ + +TP Sbjct: 1023 FECPRFARVRMEYFGELGPNPVTP 1046 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 519 EVHSTLHTFRFYCRIPNVFKND 584 ++ +T T RFY + N+F D Sbjct: 172 KIKATFDTTRFYMHLTNLFNGD 193 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 730,396 Number of Sequences: 2352 Number of extensions: 13205 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -