BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1609 (838 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73425-7|CAA97790.1| 1059|Caenorhabditis elegans Hypothetical pr... 28 7.2 Z67990-6|CAA91937.1| 199|Caenorhabditis elegans Hypothetical pr... 28 9.5 >Z73425-7|CAA97790.1| 1059|Caenorhabditis elegans Hypothetical protein F12F6.5 protein. Length = 1059 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 730 KIYDDNNNNKFYGSCAKTKVINYFLYRKSRYIVI 831 K Y+D+N K+ GS ++ YF R+ ++ V+ Sbjct: 221 KRYEDSNPGKYEGSRRHRSLVKYFKRREEKFEVV 254 >Z67990-6|CAA91937.1| 199|Caenorhabditis elegans Hypothetical protein F02D10.6 protein. Length = 199 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +3 Query: 306 YELIHL*VGRYDILTLFRFYLLLPFHISLINVIKY*YAL 422 + L+H+ Y + TL Y+++PFHISL + ++ Y + Sbjct: 76 FRLLHMCYNVYILYTLG--YMIVPFHISLYFLFEFTYTV 112 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,345,520 Number of Sequences: 27780 Number of extensions: 322465 Number of successful extensions: 687 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2066533546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -