BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1606X (431 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 23 1.5 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 4.5 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 5.9 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 5.9 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 5.9 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 289 FALCLVSYVRVLC 251 F LC+VSY+ V C Sbjct: 9 FTLCIVSYMMVRC 21 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 4.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 202 GNTARGASSPAKPSWHIPEPLTTTNAATSSSHI 104 GN + ++ A P+ EP TTT+ S HI Sbjct: 374 GNYSLVPTTTASPT---TEPSTTTSTTISQKHI 403 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.0 bits (42), Expect = 5.9 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 111 DEEVAALVVVNGSGMCQDGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ 254 D V VV G+ + DG A +A A+F + + G+ +G+G+ Sbjct: 381 DSRVTRFVVAVGATVNMDGTALYEAVAAIFIA-----QMNGISLGIGE 423 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 5.9 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 217 LPTIEGNTARGASSPAKPSWHIPE 146 + T+ A+ +P + SWH PE Sbjct: 137 ISTLYALGAKIIRTPTEASWHSPE 160 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.0 bits (42), Expect = 5.9 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +3 Query: 150 GMCQDGFAGD 179 GMC++G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,779 Number of Sequences: 438 Number of extensions: 3214 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11244597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -