BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1605 (814 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1151 - 9727051-9729510,9733966-9734022,9735299-9735676 29 5.8 03_01_0269 + 2080338-2080508,2081086-2081335,2081432-2082648,208... 29 5.8 >06_01_1151 - 9727051-9729510,9733966-9734022,9735299-9735676 Length = 964 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +3 Query: 300 MIITASFTALTF*SVSDFEGHTPVILRSDRDISN*IN 410 +I+ +FT L V DF G+T ++ + +++SN IN Sbjct: 678 LILPGTFTKLYHMQVLDFIGNTDLVFSAGKEMSNLIN 714 >03_01_0269 + 2080338-2080508,2081086-2081335,2081432-2082648, 2082933-2083083,2083247-2083563 Length = 701 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 612 IRKHSSVNNVIYQHFNNFNT 553 I KHSS N I QH NN +T Sbjct: 22 ISKHSSTNGEIKQHINNIDT 41 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,105,894 Number of Sequences: 37544 Number of extensions: 255901 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2221181676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -