BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1604 (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF426158-1|ABO26401.1| 97|Anopheles gambiae unknown protein. 23 7.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 7.9 >EF426158-1|ABO26401.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 206 KKKVLFRLLCMPGSRAQKRLSVEPEKL 286 +KK+ F +LC+ KRL PE L Sbjct: 10 RKKLQFAILCVRAMIRIKRLRYTPEPL 36 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 7.9 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -3 Query: 273 STLRRFCAREPGIHNKRNNTFFFIYKYI-FTNDH 175 S LR CA + +H +RN + Y TN H Sbjct: 3338 SVLREHCATDSSVHVRRNANSKIDFLYAGQTNSH 3371 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,241 Number of Sequences: 2352 Number of extensions: 10023 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -