BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1602 (764 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: L... 42 0.017 UniRef50_Q32RR9 Cluster: Cell division protein; n=1; Staurastrum... 36 0.83 >UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: Like moricin - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 248 Score = 41.9 bits (94), Expect = 0.017 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 11 MGDGNHLPSGGPYARLPTKAIKNKLDFVF 97 MGDGNH PSG PYA LPT+A K KL +F Sbjct: 1 MGDGNHSPSGRPYASLPTRA-KMKLTSLF 28 >UniRef50_Q32RR9 Cluster: Cell division protein; n=1; Staurastrum punctulatum|Rep: Cell division protein - Staurastrum punctulatum (Green alga) Length = 1750 Score = 36.3 bits (80), Expect = 0.83 Identities = 20/52 (38%), Positives = 30/52 (57%) Frame = +3 Query: 168 KRTKISIGLFHSVPFLYVFSV*EL*SMFSKNTHFLSWVFIILKV*CHIFFVN 323 K ++ +I LF ++PF+ F V E+ K T +L F++L V IFFVN Sbjct: 90 KNSRSTILLFFNIPFILSFLVSEIFESIIKKTIYLYRFFLLLSVPVLIFFVN 141 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,941,851 Number of Sequences: 1657284 Number of extensions: 12783092 Number of successful extensions: 25266 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25261 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63792713725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -