BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1602 (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 1.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 8.2 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = -1 Query: 413 VTLYHLKICC*F**LMQNNYKSKIMYIGNKVYEENMTSHL*NYKDPTQKMCV 258 +TL+ + IC + N K+MY GN + + L N +P + CV Sbjct: 4 ITLFMIIIC------FERNLSYKVMYNGNNNVTDLVEYVLLNEDNPCARKCV 49 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 14 GDGNHLPSGGPYARLPTKAIKNKLDFVFNSKIDL 115 G GN+ P GGP + + D F+S +L Sbjct: 530 GSGNNQPPGGPSSHVSAVLTCKVCDQAFSSLKEL 563 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 8.2 Identities = 15/66 (22%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = -1 Query: 326 KVYEENMTSHL*NYKDPTQKMCVFGK-----HRLKFSNRKNVEEGDGVKETDRYLRPFIS 162 ++Y E + +++ N + P + +F K L+ +N E +K ++ L PF++ Sbjct: 482 EIYLEALRAYVDNRRKP-KPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLA 540 Query: 161 YLWSFD 144 +W D Sbjct: 541 EIWDVD 546 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,973 Number of Sequences: 336 Number of extensions: 3533 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -