BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1602 (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 5.4 AY352277-2|AAQ67419.1| 88|Apis mellifera EX4.8-5.8 protein. 22 7.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.5 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 573 SDFTLPVSWALHFLFTVVFSLGRKFGQHVYW*Y 671 +D T+ S +VF+L R+ G H++ Y Sbjct: 189 TDCTIEYSTGNFTCIQIVFNLRRRLGYHLFHTY 221 >AY352277-2|AAQ67419.1| 88|Apis mellifera EX4.8-5.8 protein. Length = 88 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 Query: 649 PNFLPSENTTV 617 P+F PS+NTT+ Sbjct: 23 PDFAPSKNTTI 33 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -1 Query: 245 RLKFSNRKNVEEGDGVKETDRYLRPFISYLWSF 147 R K + K +GDG + +YLW F Sbjct: 431 RSKKNKLKKPRQGDGAAVKRKSREGSTTYLWEF 463 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,699 Number of Sequences: 438 Number of extensions: 3967 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -