BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1601 (805 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 25 1.1 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 25 1.1 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 25 1.1 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 24 1.4 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 2.5 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 2.5 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 2.5 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 2.5 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 2.5 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 2.5 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 2.5 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 2.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 2.5 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.5 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.5 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 7.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 7.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 7.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 7.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 7.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 7.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 7.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 7.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 7.7 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 7.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 7.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 7.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 7.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 7.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 7.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 7.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 7.7 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.6 bits (51), Expect = 1.1 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 409 PKELLQDGVLWLTMAKTELKVFIIYTFMFWVEDNGLATWVSYINCCKLWL 558 P ++Q+ + +++A +L V I+ F V L W+ I+ CKLWL Sbjct: 66 PLRIVQNFFI-VSLAVADLAVAIL-VMPFNVAYLLLGKWIFGIHLCKLWL 113 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.6 bits (51), Expect = 1.1 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 409 PKELLQDGVLWLTMAKTELKVFIIYTFMFWVEDNGLATWVSYINCCKLWL 558 P ++Q+ + +++A +L V I+ F V L W+ I+ CKLWL Sbjct: 66 PLRIVQNFFI-VSLAVADLAVAIL-VMPFNVAYLLLGKWIFGIHLCKLWL 113 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 24.6 bits (51), Expect = 1.1 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 409 PKELLQDGVLWLTMAKTELKVFIIYTFMFWVEDNGLATWVSYINCCKLWL 558 P ++Q+ + +++A +L V I+ F V L W+ I+ CKLWL Sbjct: 66 PLRIVQNFFI-VSLAVADLAVAIL-VMPFNVAYLLLGKWIFGIHLCKLWL 113 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.2 bits (50), Expect = 1.4 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 378 HLMLVARSLGAQRAPSGWRLVVNNGKDGAQSVYHLHLHVLGGRQWAG 518 H L+AR R +G + + + QS+Y HL L G ++AG Sbjct: 280 HQQLLAR-YELNRLSNGLGPIKDIDYENVQSLYQPHLRGLNGLEFAG 325 Score = 22.2 bits (45), Expect = 5.8 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 613 NYNSLFSR*NQSLSVYIKHDYCATYYHVVCCSNAE*KKDKQHTQ 744 NY++L S Q LS + + A YY V + ++++Q Q Sbjct: 197 NYSALLSHDEQQLSYFTQDIGLAAYYAQVNLAGYIQEQNQQQQQ 240 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 79 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 79 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 79 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 79 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 79 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 79 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 79 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 79 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 113 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.4 bits (48), Expect = 2.5 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +3 Query: 159 RSPQSTRNDHYDRAHNIRQDHI 224 RS + ++ YD+ HN+ + H+ Sbjct: 257 RSREYKKDRRYDQLHNVEEKHL 278 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 312 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 346 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 598 PFLI*NYNSLFSR*N--QSLSVYIKHDYCATYYHV 696 P +I N NSL + N + + Y KH+Y YY++ Sbjct: 312 PKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNI 346 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.7 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +1 Query: 538 NCCKLWLKK 564 NCC+ WL K Sbjct: 399 NCCRSWLSK 407 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.7 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +1 Query: 538 NCCKLWLKK 564 NCC+ WL K Sbjct: 399 NCCRSWLSK 407 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 8 RSREYKKKDRRYDQLHNVEEKHL 30 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 8 RSREYKKKDRRYDQLHNVEEKHL 30 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 8 RSREYKKKDRRYDQLHNVEEKHL 30 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 8 RSREYKKKDRRYDQLHNVEEKHL 30 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 8 RSREYKKKDRRYDQLHNVEEKHL 30 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 8 RSREYKKKDRRYDQLHNVEEKHL 30 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 8 RSREYKKKDRRYDQLHNVEEKHL 30 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 7.7 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 688 NMLHSNHV*CRLRGTGFILKTVNYNFILKRG*IIENTQF 572 +M HS G GF ++YN +L+R + +T + Sbjct: 212 HMSHSESTIDSKFGLGFTTDLLSYNILLRRHYSMNSTTY 250 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 257 RSREYKKKDRRYDQLHNVEEKHL 279 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 257 RSREYKKKDRRYDQLHNVEEKHL 279 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 257 RSREYKKKDRRYDQLHNVEEKHL 279 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 257 RSREYKKKDRRYDQLHNVEEKHL 279 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 257 RSREYKKKDRRYDQLHNVEEKHL 279 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 257 RSREYKKKDRRYDQLHNVEEKHL 279 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 159 RSPQSTRNDH-YDRAHNIRQDHI 224 RS + + D YD+ HN+ + H+ Sbjct: 257 RSREYKKKDRRYDQLHNVEEKHL 279 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,600 Number of Sequences: 438 Number of extensions: 5111 Number of successful extensions: 49 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -