BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1597 (627 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 26 1.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 7.9 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 Query: 562 LAASKSQIFKAPVCEPAHLSL 500 L SQ + PVCEP HL L Sbjct: 804 LLVRHSQSDEVPVCEPGHLKL 824 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 7.9 Identities = 16/54 (29%), Positives = 21/54 (38%) Frame = +1 Query: 190 SQILFINIVTQTLIVLKLEILLWSSRNNLLITMEATRRSWKLQEFVAHKANVNC 351 S I I + + L L +L W RNN L A R L+ + N C Sbjct: 913 SSIARIEAIQRKLTRYALRLLPWQDRNN-LPPYAARCRLLGLEPLSVRRRNAQC 965 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,028 Number of Sequences: 2352 Number of extensions: 12954 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -