BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1593X (591 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 23 5.6 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 5.6 AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. 23 7.4 AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. 23 7.4 AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. 23 7.4 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 23 7.4 AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. 23 7.4 AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive ... 23 7.4 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 23.4 bits (48), Expect = 5.6 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 259 MGHCLSCFKSQANAEIRSITGPHAKNDEVTDISVSV 366 + HC+ CF ++A+ E+ H DE +++ V Sbjct: 153 LDHCVFCFNNKADREVYE---SHRCKDEAGNVTCPV 185 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.4 bits (48), Expect = 5.6 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 259 MGHCLSCFKSQANAEIRSITGPHAKNDEVTDISVSV 366 + HC+ CF ++A+ E+ H DE +++ V Sbjct: 154 LDHCVFCFNNKADREVYE---SHRCKDEAGNVTCPV 186 >AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 526 NSLGVFHKLSFSAHLMDHMNF 464 N +FH L A M+H+ F Sbjct: 72 NEFDLFHSLGLFARTMEHITF 92 >AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 526 NSLGVFHKLSFSAHLMDHMNF 464 N +FH L A M+H+ F Sbjct: 72 NEFDLFHSLGLFARTMEHITF 92 >AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 526 NSLGVFHKLSFSAHLMDHMNF 464 N +FH L A M+H+ F Sbjct: 72 NEFDLFHSLGLFARTMEHITF 92 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 526 NSLGVFHKLSFSAHLMDHMNF 464 N +FH L A M+H+ F Sbjct: 72 NEFDLFHSLGLFARTMEHITF 92 >AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 526 NSLGVFHKLSFSAHLMDHMNF 464 N +FH L A M+H+ F Sbjct: 72 NEFDLFHSLGLFARTMEHITF 92 >AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive alpha-macroglobulinand complement C3-related protein IMCR14 protein. Length = 119 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 526 NSLGVFHKLSFSAHLMDHMNF 464 N +FH L A M+H+ F Sbjct: 1 NEFDLFHSLGLFARTMEHITF 21 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,289 Number of Sequences: 2352 Number of extensions: 10957 Number of successful extensions: 23 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -