BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1593X (591 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 1.7 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 22 5.2 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 6.8 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 21 6.8 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.0 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 9.0 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 9.0 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 9.0 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 9.0 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 9.0 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 9.0 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 9.0 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 9.0 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 9.0 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 9.0 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 9.0 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 9.0 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 9.0 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 9.0 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 9.0 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 9.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 9.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 9.0 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 9.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 9.0 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 9.0 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 9.0 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 9.0 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 9.0 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 9.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.0 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.4 bits (48), Expect = 1.7 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 220 FFMYSK---LYYNSFPMGHCLSCFKSQANAEIRSITG 321 FFM K YNSF G L Q A I S+TG Sbjct: 95 FFMMIKTPIFIYNSFNTGFALGNLGCQIFAVIGSLTG 131 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.8 bits (44), Expect = 5.2 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = +2 Query: 221 FLCIQNYITTVFQWATVSA--VSNLKLMLK*EVSQDPTQKMMR*QIYLFLCQFILKWSPF 394 FL + I VF + A V LK + K + + + + L + F+L WSP+ Sbjct: 68 FLFVLGLIVPVFTIVSSYAAIVLTLKKVRKRAGASGRREAKITKMVALMITAFLLAWSPY 127 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ VP P Sbjct: 105 KKLYYNINYIEQVPVP 120 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = -1 Query: 93 KLQGKISVIDIICTKIHQYQ 34 +++ + V DIICT++++ Q Sbjct: 112 EMKAIMKVDDIICTRVYKIQ 131 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 181 SFYT*CENLISFFSCYRSINVTY 113 +FY +N++S+F Y+ + Y Sbjct: 419 AFYMLYQNILSYFLRYKKLQPQY 441 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 100 KQLCYNINYIEQIPVP 115 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 100 KQLCYNINYIEQIPVP 115 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 100 KQLCYNINYIEQIPVP 115 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 100 KQLCYNINYIEQIPVP 115 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 100 KQLCYNINYIEQIPVP 115 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 105 KKLYYNINYIEQIPIP 120 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 105 KKLYYNINYIEQIPIP 120 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 109 KLQYYNINYIEQIPIP 124 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 109 KLQYYNINYIEQIPIP 124 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 109 KLQYYNINYIEQIPIP 124 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 109 KLQYYNINYIEQIPIP 124 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 99 KLQYYNINYIEQIPVP 114 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 99 KLQYYNINYIEQIPVP 114 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 99 KLQYYNINYIEQIPVP 114 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 99 KLQYYNINYIEQIPVP 114 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 104 KKLYYNINYIEQIPVP 119 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 104 KKLYYNINYIEQIPVP 119 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 106 KKLYYNINYIEQIPVP 121 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 107 KKLYYNINYIEQIPVP 122 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 107 KKLYYNINYIEQIPIP 122 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 107 KKLYYNINYIEQIPVP 122 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 107 KKLYYNINYIEQIPVP 122 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 107 KKLYYNINYIEQIPVP 122 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 107 KKLYYNINYIEQIPVP 122 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 107 KKLYYNINYIEQIPVP 122 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 107 KKLYYNINYIEQIPVP 122 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 106 KKLYYNINYIEQIPIP 121 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 106 KKLYYNINYIEQIPIP 121 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 106 KKLYYNINYIEQIPIP 121 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 106 KKLYYNINYIEQIPIP 121 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 105 KKLYYNINYIEQIPIP 120 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 110 KKLYYNINYIEQIPVP 125 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 110 KKLYYNINYIEQIPIP 125 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 110 KKLYYNINYIEQIPIP 125 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 110 KKLYYNINYIEQIPIP 125 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 115 KKLYYNINYIEQIPVP 130 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 324 KKLYYNINYIEQIPIP 339 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 320 KLQYYNINYIEQIPVP 335 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 331 KLQYYNINYIEQIPVP 346 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 331 KLQYYNINYIEQIPVP 346 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 320 KLQYYNINYIEQIPVP 335 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 324 KKLYYNINYIEQIPVP 339 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 342 KKLYYNINYIEQIPVP 357 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 K L YN YI+ +P P Sbjct: 349 KKLYYNINYIEQIPVP 364 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 254 KLL*YNFEYIKNVPHP 207 KL YN YI+ +P P Sbjct: 332 KLQYYNINYIEQIPVP 347 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,926 Number of Sequences: 438 Number of extensions: 2963 Number of successful extensions: 60 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -