BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1593X (591 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08560.1 68417.m01408 pumilio/Puf RNA-binding domain-containi... 28 4.1 At3g01030.1 68416.m00004 zinc finger (C2H2 type) family protein ... 28 4.1 >At4g08560.1 68417.m01408 pumilio/Puf RNA-binding domain-containing protein low similarity to RNA binding protein PufA [Dictyostelium discoideum] GI:5106561; contains Pfam profile PF00806: Pumilio-family RNA binding repeat Length = 477 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 503 TKFFCTFNGSHELCSPKEFNTFKLFMFVFKLFS 405 T+F CT + F FKLF+ V ++FS Sbjct: 70 TRFMCTLRQGPNYIHYQSFTAFKLFIVVVQVFS 102 >At3g01030.1 68416.m00004 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 353 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 175 KRSEKLLSRSFGCGTFFMYSKLYYNSFPMGH 267 +R++K+L R CG F+Y K +N + H Sbjct: 71 RRNKKILIRCKECGKGFLYEKCLFNHLQVTH 101 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,514,843 Number of Sequences: 28952 Number of extensions: 217215 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -