BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1587 (747 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0734 - 6078023-6078203,6078645-6078866,6079323-6079390,607... 31 0.97 03_01_0570 - 4205739-4205776,4205846-4205897,4205939-4206067,420... 28 9.1 >11_01_0734 - 6078023-6078203,6078645-6078866,6079323-6079390, 6079919-6079981,6095129-6095782 Length = 395 Score = 31.1 bits (67), Expect = 0.97 Identities = 12/44 (27%), Positives = 26/44 (59%) Frame = -1 Query: 189 AAASESIHVNSRPFLVLYSHVSYIHIELRSLRLSYYTFLQQYSI 58 ++ S SIHVN+R +Y+ ++ + E+ + + +Y FL + + Sbjct: 265 SSLSSSIHVNARNVEAMYTAITMVVQEMHARHVKHYNFLMLHGL 308 >03_01_0570 - 4205739-4205776,4205846-4205897,4205939-4206067, 4206183-4206258,4206360-4206412,4206494-4206555, 4206624-4206734,4206813-4206979,4207089-4207268, 4207598-4207687,4207773-4207921,4208367-4208501, 4208575-4208630,4208790-4208823,4209409-4209519 Length = 480 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 45 LNHIKYCIVVRKCNMTIEAISVQYEYKKHVNIRQEMV 155 +NH KY I VRK + I + Y +K V R V Sbjct: 191 INHSKYLIAVRKFHFDIVSTVCSYNTEKEVEDRNTTV 227 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,405,290 Number of Sequences: 37544 Number of extensions: 326567 Number of successful extensions: 661 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -