BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1583 (720 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 3.3 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 7.6 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.6 bits (46), Expect = 3.3 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = -2 Query: 560 KSVCTLSQGLISNDILFLCY*HCFSLIYYHFQRLSVSSASQAHSQPGNFL 411 +S C+ SQ ++S +C++ Y+ +SS++ +HSQ GN L Sbjct: 233 RSWCSSSQPVLSTTNSTT---NCYNNYPYYSNMDYLSSSTMSHSQFGNGL 279 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 719 KSRSSNSLVGFSST*RSSIFGKVQTLTLVSMPPVAIN 609 KS ++ + GF RS++FG + T T + + N Sbjct: 335 KSVANFTAAGFFDVKRSTLFGILATTTTYLIVTIQFN 371 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,953 Number of Sequences: 336 Number of extensions: 3921 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -