BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1583 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 3.8 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 3.8 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 3.8 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 6.7 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.7 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.7 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 300 VITTLGPVSWRITSSEQT 247 +ITT G +WR+ +S T Sbjct: 7 IITTTGLENWRVNNSNYT 24 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/35 (20%), Positives = 16/35 (45%) Frame = -1 Query: 330 VRFWMLLTEHVITTLGPVSWRITSSEQTSSHYVTV 226 + FW+ + + + V W + + S HY+ + Sbjct: 493 IDFWVSFVNNGVPNVNSVQWPRLNPNEKSLHYLHI 527 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/35 (20%), Positives = 16/35 (45%) Frame = -1 Query: 330 VRFWMLLTEHVITTLGPVSWRITSSEQTSSHYVTV 226 + FW+ + + + V W + + S HY+ + Sbjct: 493 IDFWVSFVNNGVPNVNSVQWPRLNPNEKSLHYLHI 527 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 627 HRHQGQSLDLSKN 665 H HQG+ + +SKN Sbjct: 543 HDHQGRPISISKN 555 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 52 FTHDILHINTIWVLR 8 F + + HINT++VLR Sbjct: 263 FENILSHINTVYVLR 277 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 52 FTHDILHINTIWVLR 8 F + + HINT++VLR Sbjct: 263 FENILSHINTVYVLR 277 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,515 Number of Sequences: 438 Number of extensions: 4545 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -