BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1583 (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52190.1 68416.m05731 transducin family protein / WD-40 repea... 36 0.027 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 32 0.33 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 32 0.33 At5g60940.2 68418.m07645 transducin family protein / WD-40 repea... 31 0.58 At5g60940.1 68418.m07644 transducin family protein / WD-40 repea... 31 0.58 At2g05720.1 68415.m00613 transducin family protein / WD-40 repea... 31 0.58 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 31 0.77 At3g49660.1 68416.m05427 transducin family protein / WD-40 repea... 31 0.77 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 31 1.0 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 31 1.0 At4g21130.1 68417.m03055 transducin family protein / WD-40 repea... 31 1.0 At4g05410.1 68417.m00823 transducin family protein / WD-40 repea... 30 1.8 At4g02730.1 68417.m00372 transducin family protein / WD-40 repea... 30 1.8 At3g10530.1 68416.m01264 transducin family protein / WD-40 repea... 30 1.8 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 30 1.8 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 30 1.8 At1g03110.1 68414.m00288 transducin family protein / WD-40 repea... 30 1.8 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 29 2.3 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 29 3.1 At5g11700.1 68418.m01367 glycine-rich protein predicted protein,... 29 3.1 At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha... 29 3.1 At5g10940.1 68418.m01269 transducin family protein / WD-40 repea... 29 4.1 At3g10140.1 68416.m01216 recA family protein contains Pfam profi... 29 4.1 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 29 4.1 At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha... 29 4.1 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 29 4.1 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 29 4.1 At1g13100.1 68414.m01519 cytochrome P450 71B29, putative (CYP71B... 29 4.1 At5g65170.1 68418.m08197 VQ motif-containing protein contains PF... 28 5.4 At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf... 28 5.4 At4g11745.1 68417.m01873 kelch repeat-containing protein similar... 28 5.4 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 28 5.4 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 28 5.4 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 28 5.4 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 28 5.4 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 28 5.4 At1g43900.1 68414.m05065 protein phosphatase 2C, putative / PP2C... 28 5.4 At1g22250.1 68414.m02781 expressed protein 28 5.4 At1g28520.1 68414.m03506 expressed protein 28 7.2 At1g13110.1 68414.m01520 cytochrome P450 71B7 (CYP71B7) identica... 28 7.2 At5g05570.1 68418.m00605 transducin family protein / WD-40 repea... 27 9.5 At4g27620.2 68417.m03970 expressed protein 27 9.5 At4g27620.1 68417.m03969 expressed protein 27 9.5 At3g51930.1 68416.m05696 transducin family protein / WD-40 repea... 27 9.5 At2g14240.1 68415.m01587 hypothetical protein and genefinder 27 9.5 At1g63540.1 68414.m07183 hydroxyproline-rich glycoprotein family... 27 9.5 At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf... 27 9.5 At1g13090.1 68414.m01518 cytochrome P450 71B28, putative (CYP71B... 27 9.5 >At3g52190.1 68416.m05731 transducin family protein / WD-40 repeat family protein similar to St12p protein (GI:166878) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat Length = 398 Score = 35.9 bits (79), Expect = 0.027 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +1 Query: 565 NDPLQRVVRISNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 N LQ+ + S +G +A GG+D +R+ +P + ++ K K + D+DF Sbjct: 121 NAGLQKCMAFSFDGSKLAVGGVDGCLRIMEWPNLSVILDEPKAHKSIRDMDF 172 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 32.3 bits (70), Expect = 0.33 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +1 Query: 583 VVRISNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 V+R + +G+ + +GG D V+VW +LL+ + ++ LDF Sbjct: 241 VLRFTPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGKIQSLDF 286 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 604 GKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 G+ A+G +DT +++W K ++ + T+ ++ L F Sbjct: 206 GEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRF 244 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 32.3 bits (70), Expect = 0.33 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = +1 Query: 523 FEIRPCDSVQTDFSNDPLQRVVRISNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKE 702 ++IR +QT + +R + +G+ + +GG+D V+VW +LL+ + Sbjct: 127 WDIRKKGCIQTYKGHSRGISTIRFTPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGP 186 Query: 703 LDDLDF 720 + LDF Sbjct: 187 IRSLDF 192 >At5g60940.2 68418.m07645 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 337 Score = 31.5 bits (68), Expect = 0.58 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +1 Query: 505 HKKRMSFEIRPCDSVQTDFSNDPLQRVVRISNNGKLMATGGIDTKVRVWTFPKME 669 H K S I P +T + + R R S +G ATGG DT ++++ PK++ Sbjct: 11 HAKGSSKTI-PKHESKTLSEHKSVVRCARFSPDGMFFATGGADTSIKLFEVPKVK 64 >At5g60940.1 68418.m07644 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 429 Score = 31.5 bits (68), Expect = 0.58 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +1 Query: 505 HKKRMSFEIRPCDSVQTDFSNDPLQRVVRISNNGKLMATGGIDTKVRVWTFPKME 669 H K S I P +T + + R R S +G ATGG DT ++++ PK++ Sbjct: 103 HAKGSSKTI-PKHESKTLSEHKSVVRCARFSPDGMFFATGGADTSIKLFEVPKVK 156 >At2g05720.1 68415.m00613 transducin family protein / WD-40 repeat family protein Similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (gi:2708305)[Homo sapiens]; contains 4 WD-40 repeats Length = 276 Score = 31.5 bits (68), Expect = 0.58 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 586 VRISNNGKLMATGGIDTKVRVWTFPKMELLYVL 684 V S NG +A+GG D + R+W +LLY++ Sbjct: 178 VDFSPNGYHLASGGEDNQCRIWDLRMRKLLYII 210 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 505 HKKRMSFEIRPCDSVQTDFSNDPLQRVVRISNNGKLMATGGIDTKVRVW 651 H K+ + E+ Q ++D ++ SN+GK +A+ G D VRVW Sbjct: 200 HCKKQAKELSALYQSQDIKAHDGAILAMKFSNDGKFLASSGEDGIVRVW 248 >At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat family protein beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 31.1 bits (67), Expect = 0.77 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +1 Query: 538 CDSVQTDFSNDPLQRVVRISNNGKLMATGGIDTKVRVWTFPKMELL 675 C D N P+ VR S NGK + G +D +R+W + L Sbjct: 189 CVKTLIDDENPPVS-FVRFSPNGKFILVGTLDNTLRLWNISSAKFL 233 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 583 VVRISNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 V+R + +G+ + +GG D V+VW +LL + ++ LDF Sbjct: 148 VLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDF 193 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 604 GKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 G+ A+G +DT +++W K ++ + T+ ++ L F Sbjct: 113 GEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRF 151 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 583 VVRISNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 V+R + +G+ + +GG D V+VW +LL + ++ LDF Sbjct: 148 VLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDF 193 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 604 GKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 G+ A+G +DT +++W K ++ + T+ ++ L F Sbjct: 113 GEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRF 151 >At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); some similarity to a group of proteins with homology to mammalian apoptosis regulators identified in zebrafish (PUBMED:10917738)Apaf-1(gi:7677507) Length = 537 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 592 ISNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDD 711 +S++G+ +ATGG+D V +W E + V + ++ D Sbjct: 214 VSSDGRYLATGGVDCHVHLWDIRTREHVQVNKLKNNQVKD 253 >At4g05410.1 68417.m00823 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); U3 snoRNP-associated 55-kDa protein, Homo sapiens, gb:NP_004695; Vegetatible incompatibility protein HET-E-1 (SP:Q00808) [Podospora anserina] Length = 504 Score = 29.9 bits (64), Expect = 1.8 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +1 Query: 592 ISNNGKLMATGGIDTKVRVW 651 +S++G+ +ATGG+D V +W Sbjct: 230 VSSDGRYLATGGVDRHVHIW 249 >At4g02730.1 68417.m00372 transducin family protein / WD-40 repeat family protein similar to C. elegans putative WD-repeat protein C14B1.4 (SP:Q17963) Length = 333 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 586 VRISNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDL 714 V+ SN+G L+A+ +D + +W+ L++ E + + DL Sbjct: 49 VKFSNDGNLLASASVDKTMILWSATNYSLIHRYEGHSSGISDL 91 >At3g10530.1 68416.m01264 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); BING4 (gi:3811380) {Mus musculus]; similar to hypothetical protein GB:P40055 [Saccharomyces cerevisiae] Length = 536 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 601 NGKLMATGGIDTKVRVWTFPKME 669 NG LMAT G + K+++W K E Sbjct: 292 NGHLMATSGKERKIKIWDLRKFE 314 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 586 VRISNNGKLMATGGIDTKVRVWTFPKMELLYVL 684 V S NG +A+GG D + R+W + LY++ Sbjct: 429 VNFSPNGYHLASGGEDNQCRIWDLRMRKSLYII 461 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +1 Query: 586 VRISNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 + S +G+ + +GG+D V+VW +LL+ + + LDF Sbjct: 97 IEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDF 141 >At1g03110.1 68414.m00288 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to WD-repeat domain 4 protein (GI:9955698) [Mus musculus] Length = 427 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +1 Query: 529 IRPCDSVQTDFSNDPLQ----RVVRISNNGKLMATGGIDTKVRVWT 654 I C D S+ P++ R +R S +GKL + G D V++W+ Sbjct: 46 IENCPVSLVDESDGPIRKESIRAIRYSTSGKLFVSAGDDKLVKIWS 91 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 505 HKKRMSFEIRPCDSV-QTDFSNDPLQRVVRISNNGKLMATGGIDTKVRVW 651 ++++ F IRP + QT + V S +GK +A+G DT VR+W Sbjct: 87 YQQQAVFRIRPVNRCSQTIAGHAEAVLCVSFSPDGKQLASGSGDTTVRLW 136 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 562 SNDPLQRVVRISNNGK--LMATGGIDTKVRVWTFPKMELLYVLEK 690 SN+ + V + NG+ L+ATG D + R+WT EL+ L K Sbjct: 320 SNEKSKDVTTLDWNGEGTLLATGSCDGQARIWTL-NGELISTLSK 363 >At5g11700.1 68418.m01367 glycine-rich protein predicted protein, Arabidopsis thaliana Length = 1411 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 325 PDVPHSGTREPLSAVQGEHP-HGGCC*NETRKFPG*EWACEAEETDSL*K 471 P SGT + + G H G CC +T+K P W +A +L K Sbjct: 167 PPPQTSGTPQGIDGAGGGHGGRGACCLTDTKKLPEDVWGGDAYSWSTLQK 216 >At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1216 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 580 RVVRISNNGKLMATGGIDTKVRVWTFPKMELLYVL 684 R V N+ L +GG D K++VW + L+ L Sbjct: 55 RGVHFHNSQPLFVSGGDDYKIKVWNYKNHRCLFTL 89 >At5g10940.1 68418.m01269 transducin family protein / WD-40 repeat family protein unnamed ORF cDNA FLJ10872, Homo sapiens, EMBL:AK001734; contains Pfam PF00400: WD domain, G-beta repeat (6 copies,1 weak) Length = 757 Score = 28.7 bits (61), Expect = 4.1 Identities = 8/31 (25%), Positives = 20/31 (64%) Frame = +1 Query: 595 SNNGKLMATGGIDTKVRVWTFPKMELLYVLE 687 ++NG L+ +G D ++ +W + +LL+ ++ Sbjct: 59 NSNGSLLISGSDDLRINIWNYSSRKLLHSID 89 >At3g10140.1 68416.m01216 recA family protein contains Pfam profile: PF00154 recA bacterial DNA recombination protein Length = 389 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 382 DVHLVQLTVALLSRCEVRPVLDAPYGTRHHDIRTSLMAHHL 260 DV +V AL +CE LDAP G R+ D ++ +M L Sbjct: 196 DVIVVDSVAALAPQCE----LDAPVGERYRDTQSRIMTQAL 232 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +1 Query: 523 FEIRPCDSVQTDFSNDPLQRVVRISNNGKLMATGGIDTKVRVWTFPKMELLYVLE 687 +++R ++QT F + V S+ + TGG+D V+VW K E LE Sbjct: 166 WDMRQRGAIQT-FPDKYQITAVSFSDAADKIFTGGVDNDVKVWDLRKGEATMTLE 219 >At2g21390.1 68415.m02546 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1218 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 580 RVVRISNNGKLMATGGIDTKVRVWTFPKMELLYVL 684 R V N+ L +GG D K++VW + L+ L Sbjct: 55 RGVHFHNSQPLFVSGGDDYKIKVWNYKTHRCLFTL 89 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 505 HKKRMSFEIRPCDSVQTDFS-NDPLQRVVRISNNGKLMATGGIDTKVRVWTFPKME 669 HKK+ C + +FS +D ++ S +GK +A+ G D VRVW+ + E Sbjct: 198 HKKQFKELSSMC--IDQEFSAHDGSILAMKFSPDGKYIASAGEDCVVRVWSITEEE 251 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 505 HKKRMSFEIRPCDSVQTDFS-NDPLQRVVRISNNGKLMATGGIDTKVRVWTFPKME 669 HKK+ C + +FS +D ++ S +GK +A+ G D VRVW+ + E Sbjct: 198 HKKQFKELSSMC--IDQEFSAHDGSILAMKFSPDGKYIASAGEDCVVRVWSITEEE 251 >At1g13100.1 68414.m01519 cytochrome P450 71B29, putative (CYP71B29) strong similarity to gb|X97864 cytochrome P450 and identical to Cytochrome P450 71B29 (SP:Q9SAE4)[Arabidopsis thaliana];PF|00067 Cytochrome P450 family Length = 490 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -1 Query: 357 WLSCPAVRYVRFWMLLTEHVITTLGPVSWRITSSEQTSSHYVTVQIFQI 211 W VR + + E + TTLG RIT + T+ HY + + +I Sbjct: 311 WAITELVRNRKVMKKVQEEIRTTLGDKKERITEQDLTNLHYFKLVVKEI 359 >At5g65170.1 68418.m08197 VQ motif-containing protein contains PF05678: VQ motif Length = 362 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -3 Query: 322 LDAPYGTRHHDIRTSLMAHHLFR-TNLFPLCDSSNISNPFATPVFDAPPPPATM 164 L +P HH + S HH + NL ++ NISNPF P P+++ Sbjct: 209 LISPSTLNHHYLPPSSEYHHHHQHQNLLLNMNTPNISNPFLNNSLTDQPKPSSL 262 >At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 709 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 583 VVRISNNGKLMATGGIDTKVRVW 651 V++ S++GK +A+ G D VRVW Sbjct: 262 VMKFSHDGKYLASAGEDCVVRVW 284 >At4g11745.1 68417.m01873 kelch repeat-containing protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profile PF01344: Kelch motif Length = 284 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 127 GKSTLANNPSDL*GDILSYNINFHYFTHD 41 G L P + D++ + INFH+ HD Sbjct: 132 GDKNLVYKPKEKTWDVVGFEINFHWIPHD 160 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 595 SNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 S +GKL+A+ G D KV +W +++ E+ + D+ F Sbjct: 517 SYDGKLLASAGHDKKVFIWNMETLQVESTPEEHAHIITDVRF 558 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 595 SNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 S +GKL+A+ G D KV +W +++ E+ + D+ F Sbjct: 519 SYDGKLLASAGHDKKVFIWNMETLQVESTPEEHAHIITDVRF 560 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 595 SNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 S +GKL+A+ G D KV +W +++ E+ + D+ F Sbjct: 519 SYDGKLLASAGHDKKVFIWNMETLQVESTPEEHAHIITDVRF 560 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 595 SNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 S +GKL+A+ G D KV +W +++ E+ + D+ F Sbjct: 519 SYDGKLLASAGHDKKVFIWNMETLQVESTPEEHAHIITDVRF 560 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 595 SNNGKLMATGGIDTKVRVWTFPKMELLYVLEKPTKELDDLDF 720 S +GKL+A+ G D KV +W +++ E+ + D+ F Sbjct: 519 SYDGKLLASAGHDKKVFIWNMETLQVESTPEEHAHIITDVRF 560 >At1g43900.1 68414.m05065 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase type 2C GI:4336436 from [Lotus japonicus] Length = 371 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 283 TSLMAHHLFRTNLFPLCDSSNISNPFATPVFDAP 182 +S + +LF + F C S N++NP P+ AP Sbjct: 40 SSFIIFYLFLCSFFWFCQSPNLTNPSPPPLSVAP 73 >At1g22250.1 68414.m02781 expressed protein Length = 200 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 467 ENDNISKKNNVSNTRKECHLKSDLVIVCRLTLVMIHCSVL 586 ++DN K+ ++ +CH+ LV++C+ TLV +C + Sbjct: 143 DDDNQKKQEMITTVCMKCHM---LVMLCKSTLVCPNCKFM 179 >At1g28520.1 68414.m03506 expressed protein Length = 486 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/56 (23%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 359 CQLYKVNIRMVDAAEMRRGSFRAEN--GLVRRRRRTVSENDNISKKNNVSNTRKEC 520 C LY++ +++VD + +G ++ L ++ R +E + N +N K C Sbjct: 386 CALYRLELKLVDGKKTSKGKVSNDSVADLQKQMGRLTAEFPPENNTTNTTNNNKRC 441 >At1g13110.1 68414.m01520 cytochrome P450 71B7 (CYP71B7) identical to (SP:Q96514) cytochrome P450 71B7 [Arabidopsis thaliana]; PF|00067 Cytochrome P450 family. ESTs gb|T44875, gb|T04814, gb|R65111, gb|T44310 and gb|T04541 come from this gene; identical to cDNA cytochrome P450 GI:1523795, ATCYP71B7 Length = 504 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -1 Query: 357 WLSCPAVRYVRFWMLLTEHVITTLGPVSWRITSSEQTSSHYVTVQIFQI 211 W +R R + + + TTLG RIT + + HY + + +I Sbjct: 317 WAMAELIRNPRVMKKVQDEIRTTLGDKKQRITEQDLSQVHYFKLVVKEI 365 >At5g05570.1 68418.m00605 transducin family protein / WD-40 repeat family protein similar to unknown protein (pir||T04661); contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 2 weak)|8683726|gb|AV524198.1|AV524198 Length = 1124 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 607 KLMATGGIDTKVRVW--TFPKMELLYVLEKPTKELD 708 +L G D +R+W T+P + L+Y+LE +D Sbjct: 492 RLYMAGYQDGSMRIWDATYPCLSLIYILEPKASVID 527 >At4g27620.2 68417.m03970 expressed protein Length = 325 Score = 27.5 bits (58), Expect = 9.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 407 SFQQHPPCGCSPCTADSGS 351 ++ QH C SPC ++SGS Sbjct: 149 AYHQHSTCSDSPCVSESGS 167 >At4g27620.1 68417.m03969 expressed protein Length = 325 Score = 27.5 bits (58), Expect = 9.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 407 SFQQHPPCGCSPCTADSGS 351 ++ QH C SPC ++SGS Sbjct: 149 AYHQHSTCSDSPCVSESGS 167 >At3g51930.1 68416.m05696 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); myosin heavy chain kinase B (SP:P90648)(GI:1903458) [Dictyostelium discoideum] Length = 415 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 604 GKLMATGGIDTKVRVWTFPKMELL 675 G ++ +GG+D +RVW PK + L Sbjct: 377 GFMLYSGGLDKSLRVWWVPKQDNL 400 >At2g14240.1 68415.m01587 hypothetical protein and genefinder Length = 128 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 152 KSTCHCCWRRR 184 +S+C CCWRRR Sbjct: 24 RSSCGCCWRRR 34 >At1g63540.1 68414.m07183 hydroxyproline-rich glycoprotein family protein Length = 635 Score = 27.5 bits (58), Expect = 9.5 Identities = 23/67 (34%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = -2 Query: 458 SVSSASQAHSQPGNFLVSFQQHPPCGCSPCTADS-GSLVPL*GTSGSGCSLRNTSSRH*D 282 S SS Q S P +F + P P + + G L TSGSG S +TSS Sbjct: 80 STSSPVQIFSSPFSFGSAHAAITPVSSGPAPSPTFGEPRILLATSGSGASATSTSSTS-S 138 Query: 281 QSHGASP 261 H +SP Sbjct: 139 PLHSSSP 145 >At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens]; similar to rab11 binding protein GI:4512103 from [Bos taurus] Length = 593 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 586 VRISNNGKLMATGGIDTKVRVW 651 ++ S +GK +ATGG D V++W Sbjct: 204 LKFSPDGKYLATGGEDGVVKIW 225 >At1g13090.1 68414.m01518 cytochrome P450 71B28, putative (CYP71B28) Identical to Cytochrome P450 (SP:Q9SAE3) [Arabidopsis thaliana]; strong similarity to gb|X97864 cytochrome P450 from Arabidopsis thaliana and is a member of the PF|00067 Cytochrome P450 family. ESTs gb|N65665, gb|T14112, gb|T76255, gb|T20906 and gb|AI100027 come from this gene Length = 490 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = -1 Query: 357 WLSCPAVRYVRFWMLLTEHVITTLGPVSWRITSSEQTSSHYVTVQIFQI 211 W +R R + + + TTLG RIT + HY + + +I Sbjct: 311 WAMTELIRNPRVMKKVQDEIRTTLGDKKERITEEDLNQLHYFKLMVKEI 359 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,272,297 Number of Sequences: 28952 Number of extensions: 350523 Number of successful extensions: 1432 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1430 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -