BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1577 (666 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 24 1.3 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 3.0 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 22 5.2 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 6.9 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.8 bits (49), Expect = 1.3 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -2 Query: 335 IISSILKSIFQNFIDRFKVFNLRINKYFRQSKSI 234 ++ S++ + ++F R+K N ++ QSKS+ Sbjct: 184 LLISLINILIRSFKSRYKDLNQKLETACEQSKSV 217 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 298 KFWNIDFKILLMIESTCSIYLF 363 KF++ID +LL I S YLF Sbjct: 411 KFFSIDNALLLSICGASSSYLF 432 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 46 ILFIYLLIKHIKSNFRIIPE 105 +L YLL+KH K ++P+ Sbjct: 31 VLNKYLLVKHSKPKMPLLPK 50 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 512 FLYSYKRKLICLLNTKRIVHFDNYAAVMTREICHVYFKY 628 FL S K K+ NT ++H + + R++ VYF + Sbjct: 64 FLRSLK-KVHLQDNTIEMIHRGTFQGDIHRDLTEVYFSF 101 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,045 Number of Sequences: 336 Number of extensions: 3224 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -