BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1576 (753 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0160 - 13656172-13656476,13656799-13657528 29 5.2 05_01_0475 - 3818121-3820565 28 9.2 >10_07_0160 - 13656172-13656476,13656799-13657528 Length = 344 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 21 NLSNIIGRGERLSTVSRIIYLSIFSLVALHYCARLYNCQIDFQHTN 158 ++S I R RL + + S+ S V + C Y+C ++HTN Sbjct: 75 SISPSICRSARLLCPNSTYFQSLSSTVFIDGCTFSYSCTFTYEHTN 120 >05_01_0475 - 3818121-3820565 Length = 814 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 590 LEIVLLNNIISNVFRMNLLFIPYYYYIVSDANSEISLNTGSHPT--WLLIY 736 + + +NN + LL YY Y++ D + +I +N S T W +Y Sbjct: 250 INMTYVNNNEEEYYEYILLDESYYAYVLLDISGQIEINVWSQDTQSWKQVY 300 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,362,505 Number of Sequences: 37544 Number of extensions: 321570 Number of successful extensions: 660 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -