BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1574 (773 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 23 2.7 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 6.3 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 23.0 bits (47), Expect = 2.7 Identities = 15/68 (22%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = +2 Query: 278 LALMF*INLLVLYTMKTID*VLILR*RITWDHI*KVLIS*YVCTS--FLSIFINLFTLAK 451 L LMF ++ L++ + + VL+ +I W H+ + +C + F + T+ + Sbjct: 244 LLLMFAVSFLIITQVIFVICVLVQSEKIVWLHLVYISFLGIICAADVFYICHVCYATIQE 303 Query: 452 IINNVSFF 475 + + FF Sbjct: 304 VRAKIYFF 311 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.8 bits (44), Expect = 6.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 219 F*IVYISFTKIEAKM*LPSFCGRLRKYPTTICVIPYLTSADT 94 F ++ S+ KI K FC L+ + I V+ LTS+ T Sbjct: 18 FLLICDSYLKIYHKEKYRKFCRILKYFIIAIYVLTILTSSVT 59 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,336 Number of Sequences: 336 Number of extensions: 3184 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -