BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1574 (773 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0356 + 12894195-12894237,12894347-12894484,12894868-128950... 31 1.0 02_04_0480 - 23274945-23275196,23275558-23275623,23276709-232768... 29 5.4 >05_03_0356 + 12894195-12894237,12894347-12894484,12894868-12895018, 12895399-12895526,12895704-12895840,12896742-12896847, 12898659-12898762,12899159-12899281,12899620-12899700, 12900159-12900304,12902171-12902243,12902970-12903060, 12904978-12905018,12906079-12906153,12906402-12906569, 12907638-12907676,12907759-12907847,12908014-12908078, 12908794-12908840,12908924-12908983,12909168-12909239, 12910143-12910172,12910526-12910617,12910719-12910802, 12911941-12912046,12912171-12912233,12912776-12912870, 12913000-12913180 Length = 875 Score = 31.1 bits (67), Expect = 1.0 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = -2 Query: 238 ISAFKWLLNSIHKFYENRGKNVIAF---FLWTFK-KISHNHLCYSVFNFGRYLNYSR*FK 71 +S+ +WL ++IH FY + ++I+F W+ K + N L +S++N Y F Sbjct: 475 LSSIEWLTSTIHTFYRDVHAHLISFLSDLKWSCKIDLVSNMLNFSMWNSLHVAKYMDKFT 534 Query: 70 IIYV 59 +I V Sbjct: 535 LIVV 538 >02_04_0480 - 23274945-23275196,23275558-23275623,23276709-23276851, 23276947-23277063,23277219-23278683,23279561-23280730 Length = 1070 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 610 CFAESTTGSESRPT*KIRQETQWAMSG*SYRTLSLFDED 726 C E T GSE PT + TQ + TLS F+ED Sbjct: 676 CSTEKTNGSEITPTTGVIPLTQENIDTVKLNTLSCFEED 714 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,172,181 Number of Sequences: 37544 Number of extensions: 277224 Number of successful extensions: 457 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2068401984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -