BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1573 (695 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.7 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 3.7 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 3.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 8.5 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 111 SLPYRRYNLLHIIN 70 SLPY +Y L++IN Sbjct: 317 SLPYYKYKYLNVIN 330 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 111 SLPYRRYNLLHIIN 70 SLPY +Y L++IN Sbjct: 317 SLPYYKYKYLNVIN 330 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 157 GWHGVSLLQMTSHVVIRSHFFLFQNLELAKFY 252 GW S M SH++ ++ + +E K+Y Sbjct: 296 GWGHTSFNGMLSHILQKTTLNMLTQVECYKYY 327 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 190 SHVVIRSHFFLFQNLELAKFYLP 258 SH V+ +FF L FY+P Sbjct: 192 SHCVVCQNFFYQIYATLGSFYIP 214 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,101 Number of Sequences: 438 Number of extensions: 3559 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -