BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1572 (703 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27440.1 68418.m03275 expressed protein 30 1.3 At3g57660.1 68416.m06424 DNA-directed RNA polymerase family prot... 29 2.3 >At5g27440.1 68418.m03275 expressed protein Length = 216 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 595 KKNLVHVNEVKLLFLCVVLWFSSFCDIFNIYI 690 KKN V + L+F+CV+LW FC I I I Sbjct: 116 KKNKVPI----LVFVCVILWIYGFCKISGIEI 143 >At3g57660.1 68416.m06424 DNA-directed RNA polymerase family protein similar to SP|O35134 DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6) (RNA polymerase I 194 kDa subunit) (RPA194) {Mus musculus}; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1670 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 116 LTYDILYNMQRKVCFVCHLHFLIK 45 L +++L+N ++ CF CH HF+ K Sbjct: 106 LLFNLLFNFLQRACFFCH-HFMAK 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,466,096 Number of Sequences: 28952 Number of extensions: 229969 Number of successful extensions: 433 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -