BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1567X (394 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0119 + 25742277-25742434,25742976-25743061,25743146-257432... 28 2.3 01_07_0290 - 42542201-42542359,42542443-42542551,42542729-425435... 27 7.1 01_06_0671 - 31076463-31076610,31077060-31077202,31077758-310779... 27 7.1 >05_06_0119 + 25742277-25742434,25742976-25743061,25743146-25743223, 25743919-25744031,25744094-25744171,25744941-25744949, 25744981-25745082,25745165-25745714,25745941-25746146, 25746868-25747031,25747157-25747310 Length = 565 Score = 28.3 bits (60), Expect = 2.3 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -3 Query: 233 INKLKSLSLNKTIA*KGKRKYFL-KNNFLSNTRLNQRH-FRKFDRYSLGCTIFDLWREL 63 + L+SLS T K +R+Y L K +F + R ++ +D Y+L DLWR++ Sbjct: 339 LTSLRSLSSAGTRDTKEQRQYILPKQHFQAPLSFWPRWAYQMYDSYALARRAADLWRQI 397 >01_07_0290 - 42542201-42542359,42542443-42542551,42542729-42543516, 42543601-42543744,42543840-42544013,42544056-42544369, 42544467-42544636,42544916-42545043,42545125-42545185, 42545473-42545642,42545783-42547387,42547479-42547631, 42547747-42547905,42548066-42548236,42548357-42548404, 42548509-42548624,42548885-42549029,42549122-42549220 Length = 1570 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 188 KGKRKYFLKN-NFLSNTRLNQRHFRKFDRYSLGCTIFDLWRELTKN 54 KG + LK F+S+T L +H ++ + C F L +TKN Sbjct: 937 KGSMREILKTVTFISSTSLCDQHTDDDKKFQVSCLQFFLPGSITKN 982 >01_06_0671 - 31076463-31076610,31077060-31077202,31077758-31077963, 31078119-31078644,31078753-31078854,31079572-31079637, 31079710-31079822,31080260-31080345,31081007-31081146 Length = 509 Score = 26.6 bits (56), Expect = 7.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 122 FRKFDRYSLGCTIFDLWRELTKN 54 + +D YSL + DLWR++ N Sbjct: 331 YEMYDSYSLARRVADLWRQIVVN 353 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,553,679 Number of Sequences: 37544 Number of extensions: 136636 Number of successful extensions: 207 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -