BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1567X (394 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 2.2 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 21 5.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 20 8.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 20 8.8 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 20 8.8 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 2.2 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 224 LKSLSLNKTIA*KGKRKYFLKNNFLSNTRLNQRH 123 + SLS NKTI KY NN +N N + Sbjct: 315 ISSLS-NKTIHNNNNYKYNYNNNNYNNNNYNNNY 347 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.0 bits (42), Expect = 5.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 61 RRMKDRSCDLC*ASYLSLNS 2 R K+ C++C Y SLNS Sbjct: 28 RPSKEPICNICKRVYSSLNS 47 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.2 bits (40), Expect = 8.8 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = -3 Query: 182 KRKYFLKNNFLSNTRLNQRHFRKFDRYSLGCTIFDLWRELTKNER 48 +++Y N+ N+R +RK+ S G + RE +K + Sbjct: 258 RKRYSRSREREQNSYKNEREYRKYRETSKGRSRDRTERERSKETK 302 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 8.8 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = -3 Query: 182 KRKYFLKNNFLSNTRLNQRHFRKFDRYSLGCTIFDLWRELTKNER 48 +++Y N+ N+R +RK+ S G + RE +K + Sbjct: 269 RKRYSRSREREQNSYKNEREYRKYRETSKGRSRDRTERERSKETK 313 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 20.2 bits (40), Expect = 8.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 137 LNQRHFRKFDRYSLGCTIFDL 75 LN+ H D +SLG +F+L Sbjct: 538 LNKGHDISADYWSLGVLMFEL 558 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,058 Number of Sequences: 438 Number of extensions: 1982 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9638226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -