BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1564 (769 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 4.7 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 4.7 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 4.7 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 6.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +1 Query: 442 ATPETQQSRCVPRTIFKTNFKRTRHRVHVPPR 537 A+P QS P F H H PPR Sbjct: 716 ASPYMLQSPLTPHEAFDVKLPPPPHPHHQPPR 747 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +1 Query: 442 ATPETQQSRCVPRTIFKTNFKRTRHRVHVPPR 537 A+P QS P F H H PPR Sbjct: 608 ASPYMLQSPLTPHEAFDVKLPPPPHPHHQPPR 639 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +2 Query: 428 VRGHQQRQKHNKAAAYRALFSKLILRGHAIEFTYHREERLIP 553 V GH Q AAAYR+ L + +A +H + P Sbjct: 21 VAGHHHEQSAAAAAAYRSFPLSLGMSPYASSQHHHHHLQARP 62 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 595 ITTAPLVPPRPPTLWDEP 542 I P PPR PT++ +P Sbjct: 133 IREKPYTPPRLPTVYGKP 150 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 607 HPLRITTAPLVPPRPPTLWDE 545 +PL T+ L+P RPP +E Sbjct: 353 NPLDAVTSGLLPVRPPLTREE 373 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,474 Number of Sequences: 336 Number of extensions: 3147 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -