BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1564 (769 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 7.9 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 7.9 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 255 VLHFKVQRIIFNVSHAVRDNFIRVV 329 VLHF QR++F +R FI V+ Sbjct: 253 VLHFDEQRVLFVNDLVIRFTFIFVL 277 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 466 RCVPRTIFKTNFKRTRHRVHVPPRGEAHPRASGGA 570 RC+ +F N+K+ R + +P G+ P SG + Sbjct: 446 RCLDTGVFPDNWKKQRLVLSIPKPGK-RPGESGSS 479 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 676,235 Number of Sequences: 2352 Number of extensions: 14432 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -